PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00103.1.g00570.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 808aa    MW: 87452.8 Da    PI: 9.7172
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00103.1.g00570.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.62.6e-33375431259
                                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                   dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers+ d++++ei+Y+g+Hnh 
  Zpz_sc00103.1.g00570.1.am.mk 375 DDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSQ-DGQITEIVYKGTHNHA 431
                                   8****************************************.***************7 PP

2WRKY105.23.6e-33528586159
                                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                   ldDgy+WrKYGqK+vkg+++prsYY+Ct+++Cpv+k+ver+++d ++v++tYeg+Hnh+
  Zpz_sc00103.1.g00570.1.am.mk 528 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTPSCPVRKHVERASHDLRAVITTYEGKHNHD 586
                                   59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.3E-29366433IPR003657WRKY domain
SuperFamilySSF1182902.62E-25369433IPR003657WRKY domain
PROSITE profilePS5081123.755369433IPR003657WRKY domain
SMARTSM007742.4E-36374432IPR003657WRKY domain
PfamPF031061.6E-25375430IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.5E-37513588IPR003657WRKY domain
SuperFamilySSF1182904.84E-29520588IPR003657WRKY domain
PROSITE profilePS5081137.688523588IPR003657WRKY domain
SMARTSM007743.5E-38528587IPR003657WRKY domain
PfamPF031064.7E-25529586IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 808 aa     Download sequence    Send to blast
MPRRHRAAPR GIASPLLVVG IGFSPSFRAL ASIERRLFNA TSFDRSMSSA QLGPNNPKEL  60
GFPPPPSSRL QSPPKSHHRA SQPGQPRHRL ETARRGSIGS CDEFNFPLFR PMTTSSSGSI  120
EVPANSRPGA FSFASTSFAD MMGAGPAAAG GASRYKAMTP PSLPLSPPLV SPSSFNILGG  180
LNPADFLDSP VLLTSSFDTT PPLPCHFGAR GRGALTFSLW TYEVQDVEQS ANAFCMFQIF  240
PSPTVGAFAS QQYSWMPAQG EEQGSNNKEE QRQSYPDFSF QTPAPTSEEA VRTTTTFQTP  300
IPSASLGEET YTSQQQQPWG FQQQSGMDAG ATQAAFGSAS TFQATSSDAT TMALHVQGSG  360
AGGYGQTQSQ RRSSDDGYNW RKYGQKQVKG SENPRSYYKC TFPNCPTKKK VERSQDGQIT  420
EIVYKGTHNH AKPQNTRRNS SSAALLLQSG DASEHSFGGT PVGTPENSAS FGDDDAAGNA  480
GGDELDEDEP DSKRWRKESE AEGLSMAGNR TVREPRVVVQ TMSDIDILDD GYRWRKYGQK  540
VVKGNPNPRS YYKCTTPSCP VRKHVERASH DLRAVITTYE GKHNHDVPAA RGSAALYRPA  600
PPPPDNHYLA AAGVRPPALA YQNSGAGQQY AHGFSGQSSF GLQSATGGSF AFSGFDDLTG  660
SYMSQHQQQQ RQNDAMHASR AKEEPREDMF FQQSMMHGGP TWRDSRPRGA SGAPRWIGGR  720
WRQPARHAGL NQTAGGFVSA VSPLQTTLIR SAYRRQESGA GACGPGFALS ENTVVFVMVR  780
RQLGRRYPAR RGRGDASKIP SRGCVLPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-36359589378Probable WRKY transcription factor 4
2lex_A4e-36359589378Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6769251e-141AY676925.1 Oryza sativa (indica cultivar-group) transcription factor WRKY24 (WRKY24) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970421.30.0PREDICTED: probable WRKY transcription factor 33
TrEMBLK3XG860.0K3XG86_SETIT; Uncharacterized protein
STRINGSi000906m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29923687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.12e-91WRKY DNA-binding protein 33